Marine drugsAnti-Bacterial AgentsGram-Positive BacteriaMicrobial Sensitivity TestsGram-Negative BacteriaAmino Acid Sequence
Truncated Equinin B Variants Reveal the Sequence Determinants of Antimicrobial Selectivity.
Mariele Staropoli, Theresa Schwaiger, Jasmina Tuzlak, Renata Biba, Lukas Petrowitsch, Johannes Fessler, Marin Roje, Matteo Cammarata, Nermina Malanović, Andreja Jakas
Published: 202610.3390/md24010046
Abstract
Equinin B (GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL), a marine peptide from Actinia equina exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. To identify a smaller active region and explore tunable properties, three pept…
Preview only. Read the full abstract at the source